Microtus fortis (reed vole): 126514774 Help Entry 126514774         CDS       T08493                                  Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism mfot  Microtus fortis (reed vole) Pathway mfot01522   Endocrine resistance mfot04110   Cell cycle mfot04115   p53 signaling pathway mfot04151   PI3K-Akt signaling pathway mfot04218   Cellular senescence mfot04530   Tight junction mfot04660   T cell receptor signaling pathway mfot04933   AGE-RAGE signaling pathway in diabetic complications mfot04934   Cushing syndrome mfot05160   Hepatitis C mfot05162   Measles mfot05163   Human cytomegalovirus infection mfot05164   Influenza A mfot05165   Human papillomavirus infection mfot05166   Human T-cell leukemia virus 1 infection mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05169   Epstein-Barr virus infection mfot05200   Pathways in cancer mfot05203   Viral carcinogenesis mfot05212   Pancreatic cancer mfot05214   Glioma mfot05218   Melanoma mfot05219   Bladder cancer mfot05220   Chronic myeloid leukemia mfot05222   Small cell lung cancer mfot05223   Non-small cell lung cancer mfot05224   Breast cancer mfot05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     126514774  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     126514774    04115 p53 signaling pathway     126514774    04218 Cellular senescence     126514774   09144 Cellular community - eukaryotes    04530 Tight junction     126514774  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     126514774  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126514774    05203 Viral carcinogenesis     126514774   09162 Cancer: specific types    05212 Pancreatic cancer     126514774    05225 Hepatocellular carcinoma     126514774    05214 Glioma     126514774    05220 Chronic myeloid leukemia     126514774    05218 Melanoma     126514774    05219 Bladder cancer     126514774    05224 Breast cancer     126514774    05222 Small cell lung cancer     126514774    05223 Non-small cell lung cancer     126514774   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     126514774    05160 Hepatitis C     126514774    05164 Influenza A     126514774    05162 Measles     126514774    05163 Human cytomegalovirus infection     126514774    05167 Kaposi sarcoma-associated herpesvirus infection     126514774    05169 Epstein-Barr virus infection     126514774    05165 Human papillomavirus infection     126514774   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     126514774    04934 Cushing syndrome     126514774   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     126514774  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mfot01001]     126514774 Enzymes [BR:mfot01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      126514774 Protein kinases [BR:mfot01001]  Serine/threonine kinases: CMGC group   CDK family    126514774 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase ABC1 Kdo Kinase-like Motif Other DBs NCBI-GeneID:  126514774 NCBI-ProteinID:  XP_050019859 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR EVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES DPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggcaacctctcggtatgaaccagtggctgaaatcggtgtcggcgcctatgggacggtg tacaaggcccgggatccccacagtggccactttgtggccctcaagagtgtgagagttcct aacggaggaggagctggagggggccttcccatcagcacagttcgtgaggtggccttactg aggaggttggaggcctttgaacatcccaatgttgtaaggctaatggatgtctgtgctact tcccgaactgatcgagacatcaaagttaccctagtgtttgagcacatagaccaggaccta aggacatacctggacaaagccccaccaccaggcttgccagttgagaccatcaaggatctg atgcggcagtttctaagcggcctagattttctgcatgcaaattgcattgttcatcgagac ctgaaaccggagaacatcctggtgacaagcaatgggaccgtcaagctggctgactttggc ttagcccgcatctacagctaccagatggccctcacccctgtggttgtcacgctctggtac cgcgcccctgaagtcctcctgcagtccacctacgccacacctgtggacatgtggagtgtt ggctgtatcttcgcagagatgttccgtcgaaagcctctcttctgtggaaactcggaagcc gaccagttgggcaaaatttttgatctcattggattgcctccagaagacgactggcctcga gaggtctctctgccccgaggagccttttccccgagagggcctcggccagtgcagtctgtg gtgccggagatggaggaatccggagcacagctactgctggagatgctgacttttaaccca cataagcggatctctgccttccgcgccctgcagcactcttacctacacaaggaagagagt gacccagagtga

DBGET integrated database retrieval system