Phodopus roborovskii (desert hamster): 127215685 Help Entry 127215685         CDS       T08852                                  Symbol Cdk4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01522   Endocrine resistance prob04110   Cell cycle prob04115   p53 signaling pathway prob04151   PI3K-Akt signaling pathway prob04218   Cellular senescence prob04530   Tight junction prob04660   T cell receptor signaling pathway prob04933   AGE-RAGE signaling pathway in diabetic complications prob04934   Cushing syndrome prob05160   Hepatitis C prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05165   Human papillomavirus infection prob05166   Human T-cell leukemia virus 1 infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05169   Epstein-Barr virus infection prob05200   Pathways in cancer prob05203   Viral carcinogenesis prob05212   Pancreatic cancer prob05214   Glioma prob05218   Melanoma prob05219   Bladder cancer prob05220   Chronic myeloid leukemia prob05222   Small cell lung cancer prob05223   Non-small cell lung cancer prob05224   Breast cancer prob05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     127215685 (Cdk4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     127215685 (Cdk4)    04115 p53 signaling pathway     127215685 (Cdk4)    04218 Cellular senescence     127215685 (Cdk4)   09144 Cellular community - eukaryotes    04530 Tight junction     127215685 (Cdk4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     127215685 (Cdk4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127215685 (Cdk4)    05203 Viral carcinogenesis     127215685 (Cdk4)   09162 Cancer: specific types    05212 Pancreatic cancer     127215685 (Cdk4)    05225 Hepatocellular carcinoma     127215685 (Cdk4)    05214 Glioma     127215685 (Cdk4)    05220 Chronic myeloid leukemia     127215685 (Cdk4)    05218 Melanoma     127215685 (Cdk4)    05219 Bladder cancer     127215685 (Cdk4)    05224 Breast cancer     127215685 (Cdk4)    05222 Small cell lung cancer     127215685 (Cdk4)    05223 Non-small cell lung cancer     127215685 (Cdk4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127215685 (Cdk4)    05160 Hepatitis C     127215685 (Cdk4)    05164 Influenza A     127215685 (Cdk4)    05162 Measles     127215685 (Cdk4)    05163 Human cytomegalovirus infection     127215685 (Cdk4)    05167 Kaposi sarcoma-associated herpesvirus infection     127215685 (Cdk4)    05169 Epstein-Barr virus infection     127215685 (Cdk4)    05165 Human papillomavirus infection     127215685 (Cdk4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     127215685 (Cdk4)    04934 Cushing syndrome     127215685 (Cdk4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     127215685 (Cdk4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:prob01001]     127215685 (Cdk4) Enzymes [BR:prob01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      127215685 (Cdk4) Protein kinases [BR:prob01001]  Serine/threonine kinases: CMGC group   CDK family    127215685 (Cdk4) BRITE hierarchy Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase ABC1 Kdo Kinase-like Motif Other DBs NCBI-GeneID:  127215685 NCBI-ProteinID:  XP_051032102 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETVKDL MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR EVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEEQ DPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctcccgctacgaaccggtggctgaaatcggtgtcggtgcctatgggacggtg tacaaggcccgagatccccacagtggccactttgtggccctcaagagtgtgcgagttccc aacggagggggagctggagggggccttcccatcagcacggtccgcgaggtggccttactg aggaggctggaggccttcgagcaccccaatgttgtgcggctaatggatgtctgtgctacc tcccgaactgatcgagacatcaaggttaccctcgtgtttgagcatatagaccaggacctg aggacgtacctagacaaagcacccccgccaggcttgccagtggagactgtcaaggacctg atgagacagtttctaagcggcctggattttcttcatgcaaattgcattgttcaccgagac ctgaaaccggagaacattctggtgacaagcaatgggacggtcaagctggctgactttggc ctggccagaatctacagctaccagatggccctcacacccgtggttgttactctttggtac cgagctcccgaagttcttctgcagtctacatacgcaacacctgtggacatgtggagcgtt gggtgtatctttgcagagatgtttcgtcgaaagcctctcttctgtgggaactctgaagct gaccagttgggcaagatatttgatctcattggattgcccccagaagatgactggcctaga gaggtgtctctgccccgaggagccttttcccccagagggccacggccagtgcagtcggtg gtgccagagatggaggaatctggagcgcagctgctgctggagatgctgacttttaaccca cataagcggatctctgccttccgagccctgcagcattcctacctacacaaggaagagcag gacccagagtga

DBGET integrated database retrieval system