Phytohabitans suffuscus: Psuf_064040 Help Entry Psuf_064040       CDS       T06545                                  Name (GenBank) hypothetical protein   KO K08641   zinc D-Ala-D-Ala dipeptidase [EC:3.4.13.22] Organism psuu  Phytohabitans suffuscus Pathway psuu01502   Vancomycin resistance psuu02020   Two-component system Brite KEGG Orthology (KO) [BR:psuu00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Psuf_064040  09160 Human Diseases   09175 Drug resistance: antimicrobial    01502 Vancomycin resistance     Psuf_064040  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:psuu01002]     Psuf_064040    01011 Peptidoglycan biosynthesis and degradation proteins [BR:psuu01011]     Psuf_064040   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:psuu01504]     Psuf_064040 Enzymes [BR:psuu01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.13  Dipeptidases     3.4.13.22  D-Ala-D-Ala dipeptidase      Psuf_064040 Peptidases and inhibitors [BR:psuu01002]  Metallo peptidases   Family M15: zinc D-Ala-D-Ala carboxypeptidase family    Psuf_064040 Peptidoglycan biosynthesis and degradation proteins [BR:psuu01011]  Peptidoglycan biosynthesis and degradation   Carboxypeptidase    Psuf_064040 Antimicrobial resistance genes [BR:psuu01504]  Gene sets   Vancomycin resistance modules    Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]     Psuf_064040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_M15 SpoVR Motif Other DBs NCBI-ProteinID:  BCB89091 UniProt:  A0A6F8YTD1 LinkDB All DBs Position 6873602..6873895 Genome browser AA seq 97 aa AA seqDB search MTLCAEGGEELDMGTAIDATPIASDNACFTAATNISARAQRHRRILSAVLVRAGFVNYPT EWWHWSFGDRYWAHVTGADRTRYGPTEFTSAAKKNGC NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gtgacgctctgcgccgagggcggcgaggagctcgacatgggtaccgccatcgacgccact ccgatcgccagcgacaacgcgtgtttcaccgcggcgaccaacatttccgcgcgggcgcag cgccaccggcggatcctttccgcggtgcttgtccgggccggtttcgtgaattacccgacg gaatggtggcactggtctttcggcgaccggtactgggcccacgtgaccggtgccgaccgg acccggtacggcccgacggaattcacgtccgcggccaagaagaacggctgttag

DBGET integrated database retrieval system