Thermofilum pendens: Tpen_1312 Help Entry Tpen_1312         CDS       T00446                                  Name (GenBank) conserved hypothetical protein   KO K21220   thiamine-phosphate diphosphorylase [EC:2.5.1.3] Organism tpe  Thermofilum pendens Pathway tpe00730   Thiamine metabolism tpe01100   Metabolic pathways tpe01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:tpe00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     Tpen_1312 Enzymes [BR:tpe01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.3  thiamine phosphate synthase      Tpen_1312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ThiP_synth Motif Other DBs NCBI-ProteinID:  ABL78709 UniProt:  A1RZS9 LinkDB All DBs Position 1259122..1259439 Genome browser AA seq 105 aa AA seqDB search MNLRFGEEVKGFLYAYAGEKGLEVGFIDRGGEPGGVARVEGASTPWKVKYLVENYGGIPG IVVEGEAPGKEPLLVILGRSAAEVAEMAVEVARRYAEWRSKRGRG NT seq 318 nt NT seq  +upstreamnt  +downstreamnt gtgaacctaaggtttggtgaagaggttaaggggtttctatacgcgtatgctggggagaag gggttggaggtcgggtttatagatcgaggtggagagccgggaggggttgcccgggtggag ggtgcttcgacgccgtggaaggtgaagtacttggtcgagaactacggggggatacccggt atagtggttgagggtgaagctcccggaaaggagcctctcctcgtaattcttggaaggagc gccgccgaggtggcggagatggctgtggaagtggctaggaggtatgccgagtggaggagt aagagaggacgaggctag

DBGET integrated database retrieval system