Vulpes lagopus (Arctic fox): 121490703 Help Entry 121490703         CDS       T07435                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg01522   Endocrine resistance vlg04110   Cell cycle vlg04115   p53 signaling pathway vlg04151   PI3K-Akt signaling pathway vlg04218   Cellular senescence vlg04530   Tight junction vlg04660   T cell receptor signaling pathway vlg04933   AGE-RAGE signaling pathway in diabetic complications vlg04934   Cushing syndrome vlg05160   Hepatitis C vlg05162   Measles vlg05163   Human cytomegalovirus infection vlg05164   Influenza A vlg05165   Human papillomavirus infection vlg05166   Human T-cell leukemia virus 1 infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05169   Epstein-Barr virus infection vlg05200   Pathways in cancer vlg05203   Viral carcinogenesis vlg05212   Pancreatic cancer vlg05214   Glioma vlg05218   Melanoma vlg05219   Bladder cancer vlg05220   Chronic myeloid leukemia vlg05222   Small cell lung cancer vlg05223   Non-small cell lung cancer vlg05224   Breast cancer vlg05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     121490703 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     121490703 (CDK4)    04115 p53 signaling pathway     121490703 (CDK4)    04218 Cellular senescence     121490703 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     121490703 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     121490703 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121490703 (CDK4)    05203 Viral carcinogenesis     121490703 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     121490703 (CDK4)    05225 Hepatocellular carcinoma     121490703 (CDK4)    05214 Glioma     121490703 (CDK4)    05220 Chronic myeloid leukemia     121490703 (CDK4)    05218 Melanoma     121490703 (CDK4)    05219 Bladder cancer     121490703 (CDK4)    05224 Breast cancer     121490703 (CDK4)    05222 Small cell lung cancer     121490703 (CDK4)    05223 Non-small cell lung cancer     121490703 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121490703 (CDK4)    05160 Hepatitis C     121490703 (CDK4)    05164 Influenza A     121490703 (CDK4)    05162 Measles     121490703 (CDK4)    05163 Human cytomegalovirus infection     121490703 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     121490703 (CDK4)    05169 Epstein-Barr virus infection     121490703 (CDK4)    05165 Human papillomavirus infection     121490703 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     121490703 (CDK4)    04934 Cushing syndrome     121490703 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     121490703 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:vlg01001]     121490703 (CDK4) Enzymes [BR:vlg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      121490703 (CDK4) Protein kinases [BR:vlg01001]  Serine/threonine kinases: CMGC group   CDK family    121490703 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  121490703 NCBI-ProteinID:  XP_041610559 LinkDB All DBs Position 5:67803344..67806285 Genome browser AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQTVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctactcctcggtacgagccagtggctgagattggggttggtgcctatggaacggtg tacaaggcccgtgatccgcacagcggccacttcgtggccctcaagagcgttagagtccct aatggaggaggtgccggagggggccttcccatcagcacagttcgtgaagtggcattgctg aggcggctggaggcttttgagcatcccaacgttgtccggctgatggacgtctgcgccact gcccgaaccgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagacctg agaacgtacctggacaaggcacccccaccgggcttgccagtggagaccatcaaggacctg atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac ctgaagcccgagaacattctggtgaccagtggtgggacagtcaagctggctgattttggt ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat cgtgctccagaagttcttctgcagtctacatatgcaacacccgtggacatgtggagtgtc ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga gatgtgtctctgccccgaggagccttttcccctagagggccccgtccagtacagacagtg gtacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt aacccagagtga

DBGET integrated database retrieval system