KEGG   Homo sapiens (human): 5594
Entry
5594              CDS       T01001                                 
Symbol
MAPK1, ERK, ERK-2, ERK2, ERT1, MAPK2, NS13, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04148  Efferocytosis
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04540  Gap junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04929  GnRH secretion
hsa04930  Type II diabetes mellitus
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05010  Alzheimer disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05034  Alcoholism
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06180  Pathogenic Escherichia coli
nt06181  Salmonella
nt06182  Shigella
nt06183  Yersinia
nt06210  ERK signaling (cancer)
nt06220  Calcium signaling (cancer)
nt06224  CXCR signaling (cancer)
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
nt06310  CRH-ACTH-cortisol signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06325  Hormone/cytokine signaling
nt06360  Cushing syndrome
nt06460  Alzheimer disease
nt06465  Prion disease
nt06466  Pathways of neurodegeneration
nt06517  TLR signaling
nt06526  MAPK signaling
nt06535  Efferocytosis
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00006  Amplified EGFR to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00008  RET fusion kinase to RAS-ERK signaling pathway
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00013  Mutation-activated BRAF to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00018  Amplified PDGFR to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00041  EGFR-overexpression to RAS-ERK signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00152  CXCR-GNB/G-ERK signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00233  IGF-IGF1R-RAS-ERK signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00248  MET-overexpression to RAS-ERK signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00259  Amplified MET to RAS-ERK signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
N00318  EGFR-ERK-ACTH signaling pathway
N00319  Mutation-activated USP8 to EGFR-ERK-ACTH signaling pathway
N00367  HPV E5 to EGFR-RAS-ERK signaling pathway
N00386  HCMV gB to PDGFR-RAS-ERK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00513  Mutation-activated EGFR to RAS-ERK signaling pathway
N00518  HCV Core to ERK signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N00545  HBV HBx to ERK signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01062  Mutation-activated MET to RAS-ERK signaling pathway
N01064  Mutation-activated RET to RAS-ERK signaling pathway
N01119  RAC/CDC42-PAK-ERK signaling pathway
N01121  Salmonella SpvC to ERK signaling pathway
N01204  PRNP-PI3K-NOX2 signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
N01343  ACH-CHRN-RAS-ERK signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
N01352  BPA to RAS-ERK signaling pathway
N01353  E2 to RAS-ERK signaling pathway
N01354  BPA to RAS-ERK signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01408  Metals to RAS-ERK signaling pathway
N01592  GF-RTK-RAS-ERK signaling pathway
N01593  Regulation of GF-RTK-RAS-ERK signaling, PTP
N01601  ERK-RSK signaling
N01602  ERK-MYC signaling pathway
N01751  Macrophage EPO signaling
N01772  Induction of the PTGS2
N01774  ERK-DUSP4 negative feedback pathway
N01775  Inactivation of CaMKII by inducing SERCA2
N01823  FGF23-NCC/NPT signaling pathway
Disease
H01738  Noonan syndrome
Drug target
Beroterkib: D12865
Ravoxertinib: D11285
Temuterkib (DG03154): D12059 D12060
Ulixertinib: D11038
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5594 (MAPK1)
   04012 ErbB signaling pathway
    5594 (MAPK1)
   04014 Ras signaling pathway
    5594 (MAPK1)
   04015 Rap1 signaling pathway
    5594 (MAPK1)
   04350 TGF-beta signaling pathway
    5594 (MAPK1)
   04370 VEGF signaling pathway
    5594 (MAPK1)
   04371 Apelin signaling pathway
    5594 (MAPK1)
   04668 TNF signaling pathway
    5594 (MAPK1)
   04066 HIF-1 signaling pathway
    5594 (MAPK1)
   04068 FoxO signaling pathway
    5594 (MAPK1)
   04072 Phospholipase D signaling pathway
    5594 (MAPK1)
   04071 Sphingolipid signaling pathway
    5594 (MAPK1)
   04024 cAMP signaling pathway
    5594 (MAPK1)
   04022 cGMP-PKG signaling pathway
    5594 (MAPK1)
   04151 PI3K-Akt signaling pathway
    5594 (MAPK1)
   04150 mTOR signaling pathway
    5594 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5594 (MAPK1)
   04148 Efferocytosis
    5594 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5594 (MAPK1)
   04210 Apoptosis
    5594 (MAPK1)
   04218 Cellular senescence
    5594 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5594 (MAPK1)
   04520 Adherens junction
    5594 (MAPK1)
   04540 Gap junction
    5594 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    5594 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5594 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5594 (MAPK1)
   04613 Neutrophil extracellular trap formation
    5594 (MAPK1)
   04620 Toll-like receptor signaling pathway
    5594 (MAPK1)
   04621 NOD-like receptor signaling pathway
    5594 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    5594 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    5594 (MAPK1)
   04660 T cell receptor signaling pathway
    5594 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    5594 (MAPK1)
   04659 Th17 cell differentiation
    5594 (MAPK1)
   04657 IL-17 signaling pathway
    5594 (MAPK1)
   04662 B cell receptor signaling pathway
    5594 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    5594 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    5594 (MAPK1)
   04062 Chemokine signaling pathway
    5594 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5594 (MAPK1)
   04929 GnRH secretion
    5594 (MAPK1)
   04912 GnRH signaling pathway
    5594 (MAPK1)
   04915 Estrogen signaling pathway
    5594 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    5594 (MAPK1)
   04917 Prolactin signaling pathway
    5594 (MAPK1)
   04921 Oxytocin signaling pathway
    5594 (MAPK1)
   04926 Relaxin signaling pathway
    5594 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    5594 (MAPK1)
   04919 Thyroid hormone signaling pathway
    5594 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    5594 (MAPK1)
   04916 Melanogenesis
    5594 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5594 (MAPK1)
   04270 Vascular smooth muscle contraction
    5594 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5594 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    5594 (MAPK1)
   04725 Cholinergic synapse
    5594 (MAPK1)
   04726 Serotonergic synapse
    5594 (MAPK1)
   04720 Long-term potentiation
    5594 (MAPK1)
   04730 Long-term depression
    5594 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    5594 (MAPK1)
   04722 Neurotrophin signaling pathway
    5594 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    5594 (MAPK1)
   04380 Osteoclast differentiation
    5594 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5594 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5594 (MAPK1)
   05206 MicroRNAs in cancer
    5594 (MAPK1)
   05205 Proteoglycans in cancer
    5594 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    5594 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    5594 (MAPK1)
   05203 Viral carcinogenesis
    5594 (MAPK1)
   05230 Central carbon metabolism in cancer
    5594 (MAPK1)
   05231 Choline metabolism in cancer
    5594 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5594 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5594 (MAPK1)
   05212 Pancreatic cancer
    5594 (MAPK1)
   05225 Hepatocellular carcinoma
    5594 (MAPK1)
   05226 Gastric cancer
    5594 (MAPK1)
   05214 Glioma
    5594 (MAPK1)
   05216 Thyroid cancer
    5594 (MAPK1)
   05221 Acute myeloid leukemia
    5594 (MAPK1)
   05220 Chronic myeloid leukemia
    5594 (MAPK1)
   05218 Melanoma
    5594 (MAPK1)
   05211 Renal cell carcinoma
    5594 (MAPK1)
   05219 Bladder cancer
    5594 (MAPK1)
   05215 Prostate cancer
    5594 (MAPK1)
   05213 Endometrial cancer
    5594 (MAPK1)
   05224 Breast cancer
    5594 (MAPK1)
   05223 Non-small cell lung cancer
    5594 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5594 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    5594 (MAPK1)
   05161 Hepatitis B
    5594 (MAPK1)
   05160 Hepatitis C
    5594 (MAPK1)
   05171 Coronavirus disease - COVID-19
    5594 (MAPK1)
   05164 Influenza A
    5594 (MAPK1)
   05163 Human cytomegalovirus infection
    5594 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5594 (MAPK1)
   05165 Human papillomavirus infection
    5594 (MAPK1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5594 (MAPK1)
   05132 Salmonella infection
    5594 (MAPK1)
   05131 Shigellosis
    5594 (MAPK1)
   05135 Yersinia infection
    5594 (MAPK1)
   05133 Pertussis
    5594 (MAPK1)
   05152 Tuberculosis
    5594 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5594 (MAPK1)
   05140 Leishmaniasis
    5594 (MAPK1)
   05142 Chagas disease
    5594 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5594 (MAPK1)
   05020 Prion disease
    5594 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    5594 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    5594 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5594 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5594 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5594 (MAPK1)
   04934 Cushing syndrome
    5594 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5594 (MAPK1)
   01524 Platinum drug resistance
    5594 (MAPK1)
   01522 Endocrine resistance
    5594 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5594 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5594 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5594 (MAPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5594 (MAPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5594 (MAPK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     5594 (MAPK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5594 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 5594
NCBI-ProteinID: NP_002736
OMIM: 176948
HGNC: 6871
Ensembl: ENSG00000100030
UniProt: P28482 Q1HBJ4 Q499G7
Structure
LinkDB
Position
22:complement(21759657..21867680)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaatgaccatatctgctattttctctaccagatcctcagagggttaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ttgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttattggacaaaatgttgacattcaacccacacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccatcgccgaagcaccattcaagttcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacagatct
taa

KEGG   Homo sapiens (human): 5595
Entry
5595              CDS       T01001                                 
Symbol
MAPK3, ERK-1, ERK1, ERT2, HS44KDAP, HUMKER1A, P44ERK1, P44MAPK, PRKM3, p44-ERK1, p44-MAPK
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04148  Efferocytosis
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04540  Gap junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04929  GnRH secretion
hsa04930  Type II diabetes mellitus
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05010  Alzheimer disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05034  Alcoholism
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06180  Pathogenic Escherichia coli
nt06181  Salmonella
nt06182  Shigella
nt06183  Yersinia
nt06210  ERK signaling (cancer)
nt06220  Calcium signaling (cancer)
nt06224  CXCR signaling (cancer)
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
nt06310  CRH-ACTH-cortisol signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06325  Hormone/cytokine signaling
nt06360  Cushing syndrome
nt06460  Alzheimer disease
nt06465  Prion disease
nt06466  Pathways of neurodegeneration
nt06517  TLR signaling
nt06526  MAPK signaling
nt06535  Efferocytosis
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00006  Amplified EGFR to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00008  RET fusion kinase to RAS-ERK signaling pathway
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00013  Mutation-activated BRAF to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00018  Amplified PDGFR to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00041  EGFR-overexpression to RAS-ERK signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00152  CXCR-GNB/G-ERK signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00233  IGF-IGF1R-RAS-ERK signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00248  MET-overexpression to RAS-ERK signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00259  Amplified MET to RAS-ERK signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
N00318  EGFR-ERK-ACTH signaling pathway
N00319  Mutation-activated USP8 to EGFR-ERK-ACTH signaling pathway
N00367  HPV E5 to EGFR-RAS-ERK signaling pathway
N00386  HCMV gB to PDGFR-RAS-ERK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00513  Mutation-activated EGFR to RAS-ERK signaling pathway
N00518  HCV Core to ERK signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N00545  HBV HBx to ERK signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01062  Mutation-activated MET to RAS-ERK signaling pathway
N01064  Mutation-activated RET to RAS-ERK signaling pathway
N01119  RAC/CDC42-PAK-ERK signaling pathway
N01121  Salmonella SpvC to ERK signaling pathway
N01204  PRNP-PI3K-NOX2 signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
N01343  ACH-CHRN-RAS-ERK signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
N01352  BPA to RAS-ERK signaling pathway
N01353  E2 to RAS-ERK signaling pathway
N01354  BPA to RAS-ERK signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01408  Metals to RAS-ERK signaling pathway
N01592  GF-RTK-RAS-ERK signaling pathway
N01593  Regulation of GF-RTK-RAS-ERK signaling, PTP
N01601  ERK-RSK signaling
N01602  ERK-MYC signaling pathway
N01751  Macrophage EPO signaling
N01772  Induction of the PTGS2
N01774  ERK-DUSP4 negative feedback pathway
N01775  Inactivation of CaMKII by inducing SERCA2
N01823  FGF23-NCC/NPT signaling pathway
Drug target
Beroterkib: D12865
Ravoxertinib: D11285
Temuterkib (DG03154): D12059 D12060
Ulixertinib: D11038
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5595 (MAPK3)
   04012 ErbB signaling pathway
    5595 (MAPK3)
   04014 Ras signaling pathway
    5595 (MAPK3)
   04015 Rap1 signaling pathway
    5595 (MAPK3)
   04350 TGF-beta signaling pathway
    5595 (MAPK3)
   04370 VEGF signaling pathway
    5595 (MAPK3)
   04371 Apelin signaling pathway
    5595 (MAPK3)
   04668 TNF signaling pathway
    5595 (MAPK3)
   04066 HIF-1 signaling pathway
    5595 (MAPK3)
   04068 FoxO signaling pathway
    5595 (MAPK3)
   04072 Phospholipase D signaling pathway
    5595 (MAPK3)
   04071 Sphingolipid signaling pathway
    5595 (MAPK3)
   04024 cAMP signaling pathway
    5595 (MAPK3)
   04022 cGMP-PKG signaling pathway
    5595 (MAPK3)
   04151 PI3K-Akt signaling pathway
    5595 (MAPK3)
   04150 mTOR signaling pathway
    5595 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5595 (MAPK3)
   04148 Efferocytosis
    5595 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5595 (MAPK3)
   04210 Apoptosis
    5595 (MAPK3)
   04218 Cellular senescence
    5595 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5595 (MAPK3)
   04520 Adherens junction
    5595 (MAPK3)
   04540 Gap junction
    5595 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    5595 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5595 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5595 (MAPK3)
   04613 Neutrophil extracellular trap formation
    5595 (MAPK3)
   04620 Toll-like receptor signaling pathway
    5595 (MAPK3)
   04621 NOD-like receptor signaling pathway
    5595 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    5595 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    5595 (MAPK3)
   04660 T cell receptor signaling pathway
    5595 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    5595 (MAPK3)
   04659 Th17 cell differentiation
    5595 (MAPK3)
   04657 IL-17 signaling pathway
    5595 (MAPK3)
   04662 B cell receptor signaling pathway
    5595 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    5595 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    5595 (MAPK3)
   04062 Chemokine signaling pathway
    5595 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5595 (MAPK3)
   04929 GnRH secretion
    5595 (MAPK3)
   04912 GnRH signaling pathway
    5595 (MAPK3)
   04915 Estrogen signaling pathway
    5595 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    5595 (MAPK3)
   04917 Prolactin signaling pathway
    5595 (MAPK3)
   04921 Oxytocin signaling pathway
    5595 (MAPK3)
   04926 Relaxin signaling pathway
    5595 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    5595 (MAPK3)
   04919 Thyroid hormone signaling pathway
    5595 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    5595 (MAPK3)
   04916 Melanogenesis
    5595 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5595 (MAPK3)
   04270 Vascular smooth muscle contraction
    5595 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5595 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    5595 (MAPK3)
   04725 Cholinergic synapse
    5595 (MAPK3)
   04726 Serotonergic synapse
    5595 (MAPK3)
   04720 Long-term potentiation
    5595 (MAPK3)
   04730 Long-term depression
    5595 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    5595 (MAPK3)
   04722 Neurotrophin signaling pathway
    5595 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    5595 (MAPK3)
   04380 Osteoclast differentiation
    5595 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5595 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5595 (MAPK3)
   05206 MicroRNAs in cancer
    5595 (MAPK3)
   05205 Proteoglycans in cancer
    5595 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    5595 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    5595 (MAPK3)
   05203 Viral carcinogenesis
    5595 (MAPK3)
   05230 Central carbon metabolism in cancer
    5595 (MAPK3)
   05231 Choline metabolism in cancer
    5595 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5595 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5595 (MAPK3)
   05212 Pancreatic cancer
    5595 (MAPK3)
   05225 Hepatocellular carcinoma
    5595 (MAPK3)
   05226 Gastric cancer
    5595 (MAPK3)
   05214 Glioma
    5595 (MAPK3)
   05216 Thyroid cancer
    5595 (MAPK3)
   05221 Acute myeloid leukemia
    5595 (MAPK3)
   05220 Chronic myeloid leukemia
    5595 (MAPK3)
   05218 Melanoma
    5595 (MAPK3)
   05211 Renal cell carcinoma
    5595 (MAPK3)
   05219 Bladder cancer
    5595 (MAPK3)
   05215 Prostate cancer
    5595 (MAPK3)
   05213 Endometrial cancer
    5595 (MAPK3)
   05224 Breast cancer
    5595 (MAPK3)
   05223 Non-small cell lung cancer
    5595 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5595 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    5595 (MAPK3)
   05161 Hepatitis B
    5595 (MAPK3)
   05160 Hepatitis C
    5595 (MAPK3)
   05171 Coronavirus disease - COVID-19
    5595 (MAPK3)
   05164 Influenza A
    5595 (MAPK3)
   05163 Human cytomegalovirus infection
    5595 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5595 (MAPK3)
   05165 Human papillomavirus infection
    5595 (MAPK3)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5595 (MAPK3)
   05132 Salmonella infection
    5595 (MAPK3)
   05131 Shigellosis
    5595 (MAPK3)
   05135 Yersinia infection
    5595 (MAPK3)
   05133 Pertussis
    5595 (MAPK3)
   05152 Tuberculosis
    5595 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5595 (MAPK3)
   05140 Leishmaniasis
    5595 (MAPK3)
   05142 Chagas disease
    5595 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5595 (MAPK3)
   05020 Prion disease
    5595 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    5595 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    5595 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5595 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5595 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5595 (MAPK3)
   04934 Cushing syndrome
    5595 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5595 (MAPK3)
   01524 Platinum drug resistance
    5595 (MAPK3)
   01522 Endocrine resistance
    5595 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5595 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5595 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5595 (MAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5595 (MAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5595 (MAPK3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     5595 (MAPK3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5595 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 5595
NCBI-ProteinID: NP_002737
OMIM: 601795
HGNC: 6877
Ensembl: ENSG00000102882
UniProt: P27361 L7RXH5
Structure
LinkDB
Position
16:complement(30114105..30123220)
AA seq 379 aa
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgaacatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgggcgtccaccctggaagccatgagagatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagcaat
gaccatatctgctacttcctctaccagatcctgcggggcctcaagtacatccactccgcc
aacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgtgatttcggcctggcccggattgccgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggccccctag

KEGG   Homo sapiens (human): 1432
Entry
1432              CDS       T01001                                 
Symbol
MAPK14, CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Name
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04148  Efferocytosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04936  Alcoholic liver disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06180  Pathogenic Escherichia coli
nt06182  Shigella
nt06183  Yersinia
nt06211  Other MAPK signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06516  TNF signaling
nt06517  TLR signaling
nt06526  MAPK signaling
nt06535  Efferocytosis
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00445  HIV Tat/Nef to TNF-p38 signaling pathway
N00931  Escherichia NleD to TNF-p38 signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
N01593  Regulation of GF-RTK-RAS-ERK signaling, PTP
N01776  CaMK2-p38-MK2-ALOX5 pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Pamapimod: D08963
Ralimetinib (DG01847): D10658 D10659
Talmapimod: D09386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1432 (MAPK14)
   04015 Rap1 signaling pathway
    1432 (MAPK14)
   04370 VEGF signaling pathway
    1432 (MAPK14)
   04668 TNF signaling pathway
    1432 (MAPK14)
   04068 FoxO signaling pathway
    1432 (MAPK14)
   04071 Sphingolipid signaling pathway
    1432 (MAPK14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    1432 (MAPK14)
  09143 Cell growth and death
   04114 Oocyte meiosis
    1432 (MAPK14)
   04218 Cellular senescence
    1432 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1432 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    1432 (MAPK14)
   04613 Neutrophil extracellular trap formation
    1432 (MAPK14)
   04620 Toll-like receptor signaling pathway
    1432 (MAPK14)
   04621 NOD-like receptor signaling pathway
    1432 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    1432 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    1432 (MAPK14)
   04660 T cell receptor signaling pathway
    1432 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    1432 (MAPK14)
   04659 Th17 cell differentiation
    1432 (MAPK14)
   04657 IL-17 signaling pathway
    1432 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    1432 (MAPK14)
   04670 Leukocyte transendothelial migration
    1432 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    1432 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    1432 (MAPK14)
   04917 Prolactin signaling pathway
    1432 (MAPK14)
   04926 Relaxin signaling pathway
    1432 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    1432 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1432 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    1432 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    1432 (MAPK14)
   04722 Neurotrophin signaling pathway
    1432 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1432 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1432 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    1432 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    1432 (MAPK14)
   05208 Chemical carcinogenesis - reactive oxygen species
    1432 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    1432 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1432 (MAPK14)
   05161 Hepatitis B
    1432 (MAPK14)
   05171 Coronavirus disease - COVID-19
    1432 (MAPK14)
   05163 Human cytomegalovirus infection
    1432 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1432 (MAPK14)
   05169 Epstein-Barr virus infection
    1432 (MAPK14)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1432 (MAPK14)
   05130 Pathogenic Escherichia coli infection
    1432 (MAPK14)
   05132 Salmonella infection
    1432 (MAPK14)
   05131 Shigellosis
    1432 (MAPK14)
   05135 Yersinia infection
    1432 (MAPK14)
   05133 Pertussis
    1432 (MAPK14)
   05152 Tuberculosis
    1432 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    1432 (MAPK14)
   05140 Leishmaniasis
    1432 (MAPK14)
   05142 Chagas disease
    1432 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1432 (MAPK14)
   05020 Prion disease
    1432 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    1432 (MAPK14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1432 (MAPK14)
   05418 Fluid shear stress and atherosclerosis
    1432 (MAPK14)
   05415 Diabetic cardiomyopathy
    1432 (MAPK14)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    1432 (MAPK14)
   04932 Non-alcoholic fatty liver disease
    1432 (MAPK14)
   04933 AGE-RAGE signaling pathway in diabetic complications
    1432 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1432 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1432 (MAPK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     1432 (MAPK14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   1432 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8
Other DBs
NCBI-GeneID: 1432
NCBI-ProteinID: NP_001306
OMIM: 600289
HGNC: 6876
Ensembl: ENSG00000112062
UniProt: Q16539 L7RSM2
Structure
LinkDB
Position
6:36027808..36124214
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Homo sapiens (human): 5600
Entry
5600              CDS       T01001                                 
Symbol
MAPK11, P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Name
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04148  Efferocytosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04936  Alcoholic liver disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06180  Pathogenic Escherichia coli
nt06182  Shigella
nt06183  Yersinia
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06535  Efferocytosis
  Element
N00438  TLR2/4-MAPK signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
N01776  CaMK2-p38-MK2-ALOX5 pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5600 (MAPK11)
   04015 Rap1 signaling pathway
    5600 (MAPK11)
   04370 VEGF signaling pathway
    5600 (MAPK11)
   04668 TNF signaling pathway
    5600 (MAPK11)
   04068 FoxO signaling pathway
    5600 (MAPK11)
   04071 Sphingolipid signaling pathway
    5600 (MAPK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    5600 (MAPK11)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5600 (MAPK11)
   04218 Cellular senescence
    5600 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5600 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5600 (MAPK11)
   04613 Neutrophil extracellular trap formation
    5600 (MAPK11)
   04620 Toll-like receptor signaling pathway
    5600 (MAPK11)
   04621 NOD-like receptor signaling pathway
    5600 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    5600 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    5600 (MAPK11)
   04660 T cell receptor signaling pathway
    5600 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    5600 (MAPK11)
   04659 Th17 cell differentiation
    5600 (MAPK11)
   04657 IL-17 signaling pathway
    5600 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    5600 (MAPK11)
   04670 Leukocyte transendothelial migration
    5600 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5600 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    5600 (MAPK11)
   04917 Prolactin signaling pathway
    5600 (MAPK11)
   04926 Relaxin signaling pathway
    5600 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    5600 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5600 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    5600 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    5600 (MAPK11)
   04722 Neurotrophin signaling pathway
    5600 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5600 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5600 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    5600 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    5600 (MAPK11)
   05208 Chemical carcinogenesis - reactive oxygen species
    5600 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5600 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5600 (MAPK11)
   05161 Hepatitis B
    5600 (MAPK11)
   05171 Coronavirus disease - COVID-19
    5600 (MAPK11)
   05163 Human cytomegalovirus infection
    5600 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5600 (MAPK11)
   05169 Epstein-Barr virus infection
    5600 (MAPK11)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5600 (MAPK11)
   05130 Pathogenic Escherichia coli infection
    5600 (MAPK11)
   05132 Salmonella infection
    5600 (MAPK11)
   05131 Shigellosis
    5600 (MAPK11)
   05135 Yersinia infection
    5600 (MAPK11)
   05133 Pertussis
    5600 (MAPK11)
   05152 Tuberculosis
    5600 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5600 (MAPK11)
   05140 Leishmaniasis
    5600 (MAPK11)
   05142 Chagas disease
    5600 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5600 (MAPK11)
   05020 Prion disease
    5600 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    5600 (MAPK11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5600 (MAPK11)
   05418 Fluid shear stress and atherosclerosis
    5600 (MAPK11)
   05415 Diabetic cardiomyopathy
    5600 (MAPK11)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    5600 (MAPK11)
   04932 Non-alcoholic fatty liver disease
    5600 (MAPK11)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5600 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5600 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5600 (MAPK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5600 (MAPK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5600 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 FTA2
Other DBs
NCBI-GeneID: 5600
NCBI-ProteinID: NP_002742
OMIM: 602898
HGNC: 6873
Ensembl: ENSG00000185386
UniProt: Q15759
Structure
LinkDB
Position
22:complement(50263713..50270380)
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggattttgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcagct
gaggcactggcccacgcctacttcagccagtaccacgaccccgaggatgagccagaggcc
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Homo sapiens (human): 5603
Entry
5603              CDS       T01001                                 
Symbol
MAPK13, MAPK_13, MAPK-13, PRKM13, SAPK4, p38delta
Name
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04148  Efferocytosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04936  Alcoholic liver disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06180  Pathogenic Escherichia coli
nt06182  Shigella
nt06183  Yersinia
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06535  Efferocytosis
  Element
N00438  TLR2/4-MAPK signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
N01776  CaMK2-p38-MK2-ALOX5 pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5603 (MAPK13)
   04015 Rap1 signaling pathway
    5603 (MAPK13)
   04370 VEGF signaling pathway
    5603 (MAPK13)
   04668 TNF signaling pathway
    5603 (MAPK13)
   04068 FoxO signaling pathway
    5603 (MAPK13)
   04071 Sphingolipid signaling pathway
    5603 (MAPK13)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    5603 (MAPK13)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5603 (MAPK13)
   04218 Cellular senescence
    5603 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5603 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5603 (MAPK13)
   04613 Neutrophil extracellular trap formation
    5603 (MAPK13)
   04620 Toll-like receptor signaling pathway
    5603 (MAPK13)
   04621 NOD-like receptor signaling pathway
    5603 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    5603 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    5603 (MAPK13)
   04660 T cell receptor signaling pathway
    5603 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    5603 (MAPK13)
   04659 Th17 cell differentiation
    5603 (MAPK13)
   04657 IL-17 signaling pathway
    5603 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    5603 (MAPK13)
   04670 Leukocyte transendothelial migration
    5603 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5603 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    5603 (MAPK13)
   04917 Prolactin signaling pathway
    5603 (MAPK13)
   04926 Relaxin signaling pathway
    5603 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    5603 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5603 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    5603 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    5603 (MAPK13)
   04722 Neurotrophin signaling pathway
    5603 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5603 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5603 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    5603 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    5603 (MAPK13)
   05208 Chemical carcinogenesis - reactive oxygen species
    5603 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5603 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5603 (MAPK13)
   05161 Hepatitis B
    5603 (MAPK13)
   05171 Coronavirus disease - COVID-19
    5603 (MAPK13)
   05163 Human cytomegalovirus infection
    5603 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5603 (MAPK13)
   05169 Epstein-Barr virus infection
    5603 (MAPK13)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5603 (MAPK13)
   05130 Pathogenic Escherichia coli infection
    5603 (MAPK13)
   05132 Salmonella infection
    5603 (MAPK13)
   05131 Shigellosis
    5603 (MAPK13)
   05135 Yersinia infection
    5603 (MAPK13)
   05133 Pertussis
    5603 (MAPK13)
   05152 Tuberculosis
    5603 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5603 (MAPK13)
   05140 Leishmaniasis
    5603 (MAPK13)
   05142 Chagas disease
    5603 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5603 (MAPK13)
   05020 Prion disease
    5603 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    5603 (MAPK13)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5603 (MAPK13)
   05418 Fluid shear stress and atherosclerosis
    5603 (MAPK13)
   05415 Diabetic cardiomyopathy
    5603 (MAPK13)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    5603 (MAPK13)
   04932 Non-alcoholic fatty liver disease
    5603 (MAPK13)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5603 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5603 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5603 (MAPK13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5603 (MAPK13)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5603 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH RIO1 Kdo Kinase-like DUF4023 US2
Other DBs
NCBI-GeneID: 5603
NCBI-ProteinID: NP_002745
OMIM: 602899
HGNC: 6875
Ensembl: ENSG00000156711
UniProt: O15264 A0A024RD04
Structure
LinkDB
Position
6:36130513..36144521
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagacagcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
tatgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactctgctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

KEGG   Homo sapiens (human): 6300
Entry
6300              CDS       T01001                                 
Symbol
MAPK12, ERK-6, ERK3, ERK6, MAPK_12, P38GAMMA, PRKM12, SAPK-3, SAPK3
Name
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04148  Efferocytosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04936  Alcoholic liver disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06180  Pathogenic Escherichia coli
nt06182  Shigella
nt06183  Yersinia
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06535  Efferocytosis
  Element
N00438  TLR2/4-MAPK signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
N01776  CaMK2-p38-MK2-ALOX5 pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6300 (MAPK12)
   04015 Rap1 signaling pathway
    6300 (MAPK12)
   04370 VEGF signaling pathway
    6300 (MAPK12)
   04668 TNF signaling pathway
    6300 (MAPK12)
   04068 FoxO signaling pathway
    6300 (MAPK12)
   04071 Sphingolipid signaling pathway
    6300 (MAPK12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    6300 (MAPK12)
  09143 Cell growth and death
   04114 Oocyte meiosis
    6300 (MAPK12)
   04218 Cellular senescence
    6300 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6300 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6300 (MAPK12)
   04613 Neutrophil extracellular trap formation
    6300 (MAPK12)
   04620 Toll-like receptor signaling pathway
    6300 (MAPK12)
   04621 NOD-like receptor signaling pathway
    6300 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    6300 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    6300 (MAPK12)
   04660 T cell receptor signaling pathway
    6300 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    6300 (MAPK12)
   04659 Th17 cell differentiation
    6300 (MAPK12)
   04657 IL-17 signaling pathway
    6300 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    6300 (MAPK12)
   04670 Leukocyte transendothelial migration
    6300 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6300 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    6300 (MAPK12)
   04917 Prolactin signaling pathway
    6300 (MAPK12)
   04926 Relaxin signaling pathway
    6300 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    6300 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6300 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    6300 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    6300 (MAPK12)
   04722 Neurotrophin signaling pathway
    6300 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6300 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    6300 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    6300 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6300 (MAPK12)
   05208 Chemical carcinogenesis - reactive oxygen species
    6300 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    6300 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6300 (MAPK12)
   05161 Hepatitis B
    6300 (MAPK12)
   05171 Coronavirus disease - COVID-19
    6300 (MAPK12)
   05163 Human cytomegalovirus infection
    6300 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6300 (MAPK12)
   05169 Epstein-Barr virus infection
    6300 (MAPK12)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6300 (MAPK12)
   05130 Pathogenic Escherichia coli infection
    6300 (MAPK12)
   05132 Salmonella infection
    6300 (MAPK12)
   05131 Shigellosis
    6300 (MAPK12)
   05135 Yersinia infection
    6300 (MAPK12)
   05133 Pertussis
    6300 (MAPK12)
   05152 Tuberculosis
    6300 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    6300 (MAPK12)
   05140 Leishmaniasis
    6300 (MAPK12)
   05142 Chagas disease
    6300 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6300 (MAPK12)
   05020 Prion disease
    6300 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    6300 (MAPK12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6300 (MAPK12)
   05418 Fluid shear stress and atherosclerosis
    6300 (MAPK12)
   05415 Diabetic cardiomyopathy
    6300 (MAPK12)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    6300 (MAPK12)
   04932 Non-alcoholic fatty liver disease
    6300 (MAPK12)
   04933 AGE-RAGE signaling pathway in diabetic complications
    6300 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    6300 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6300 (MAPK12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6300 (MAPK12)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   6300 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Peripla_BP_5 Kinase-like Haspin_kinase
Other DBs
NCBI-GeneID: 6300
NCBI-ProteinID: NP_002960
OMIM: 602399
HGNC: 6874
Ensembl: ENSG00000188130
UniProt: P53778
Structure
LinkDB
Position
22:complement(50252901..50261683)
AA seq 367 aa
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacggccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cctttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcaggcgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgttgaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacgcctctgtga

DBGET integrated database retrieval system